PAK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003565

 

Antibody CAB005312

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA003565 sc-881 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

115  

Antigen sequence

NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPP
PVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTR
NTEKQKKKPKMSDEE
 
 

Matching transcripts

PAK1-001 - ENSP00000348696 [100%]
PAK1-002 - ENSP00000278568 [100%]
PAK1-003 - ENSP00000433423 [100%]
PAK1-004 - ENSP00000433211 [100%]
PAK1-014 - ENSP00000431906 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:118  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

61.6, 60.6, 58.2, 50.9, 18.5 61.6, 60.6, 58.2, 50.9, 27.1, 18.5, 11.8, 10.9, 9.9, 6.8, 2.8, 2.0 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PAK1-001
 
PAK1-002
 
PAK1-003
 
PAK1-004
 
PAK1-014