ALDOA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004177

 

Antibody CAB006252

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA004177 H00000226-M02 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

106  

Antigen sequence

IVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNP
CIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGE
TTTQGL
 
 

Matching transcripts

ALDOA-001 - ENSP00000455917 [100%]
ALDOA-002 - ENSP00000378669 [100%]
ALDOA-004 - ENSP00000455724 [100%]
ALDOA-005 - ENSP00000336927 [100%]
ALDOA-006 - ENSP00000455800 [100%]
ALDOA-007 - ENSP00000455700 [100%]
ALDOA-008 - ENSP00000400452 [100%]
ALDOA-009 - ENSP00000457468 [100%]
ALDOA-010 - ENSP00000455857 [100%]
ALDOA-011 - ENSP00000378661 [100%]
ALDOA-019 - ENSP00000455455 [100%]
ALDOA-020 - ENSP00000457643 [100%]
ALDOA-017 - ENSP00000456020 [86%]
ALDOA-030 - ENSP00000454499 [86%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine pancreas and islet cells.
More information
 Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:250 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

1:19 1:62 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.3, 39.8, 39.4, 39.3, 30.4, 17.8, 16.9, 15.5 45.3, 39.8, 39.4, 39.3, 30.4, 22.1, 17.8, 16.9, 15.5, 13.7, 1.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 « 
 
ALDOA-001
 
ALDOA-002
 
ALDOA-004
 
ALDOA-005
 
ALDOA-006
 
ALDOA-007
 
ALDOA-008
 
ALDOA-009
 
ALDOA-010
 
ALDOA-011
 
ALDOA-017
 
ALDOA-019
 
ALDOA-020
 
ALDOA-030
 
 »