UBC

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041344

 

Antibody HPA049132

 

Antibody CAB000362

 

Antibody CAB005419

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 AbD Serotec
 Santa Cruz Biotechnology
 

Product name

HPA041344 HPA049132 MCA1398GT sc-9133 

Host species

Rabbit Rabbit Mouse Rabbit 

Clonality

pAb pAb mAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

10 10 1 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Recombinant protein 

Length (aa)

41 36   

Antigen sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
 
GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
 
 
 

Matching transcripts

UBC-001 - ENSP00000344818 [100%]
UBC-003 - ENSP00000443053 [100%]
UBC-007 - ENSP00000441543 [100%]
UBC-008 - ENSP00000441556 [100%]
UBC-009 - ENSP00000442800 [100%]
UBC-011 - ENSP00000441238 [100%]
UBC-012 - ENSP00000438289 [100%]
UBC-013 - ENSP00000437452 [100%]
UBC-014 - ENSP00000445337 [100%]
UBC-015 - ENSP00000439492 [100%]
UBC-016 - ENSP00000440205 [100%]
UBC-201 - ENSP00000438394 [100%]
 UBC-001 - ENSP00000344818 [100%]
UBC-003 - ENSP00000443053 [100%]
UBC-007 - ENSP00000441543 [100%]
UBC-009 - ENSP00000442800 [100%]
UBC-011 - ENSP00000441238 [100%]
UBC-012 - ENSP00000438289 [100%]
UBC-013 - ENSP00000437452 [100%]
UBC-014 - ENSP00000445337 [100%]
UBC-015 - ENSP00000439492 [100%]
UBC-016 - ENSP00000440205 [100%]
UBC-201 - ENSP00000438394 [100%]
UBC-008 - ENSP00000441556 [97%]
   

Other gene match

RPS27A - ENSG00000143947 [100%]
UBB - ENSG00000170315 [100%]
UBA52 - ENSG00000221983 [100%]
UBBP4 - ENSG00000263563 [100%]
 RPS27A - ENSG00000143947 [97%]
UBB - ENSG00000170315 [100%]
UBA52 - ENSG00000221983 [97%]
UBBP4 - ENSG00000263563 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human nasopharynx shows strong nuclear and cytoplasmic positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human placenta shows distinct nuclear and cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 None HIER pH6 

Antibody dilution

1:50 1:450 1:1000 1:100 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

77.0, 68.5, 34.3, 25.8, 25.2, 23.2, 19.0, 18.2, 18.0, 17.5, 17.2, 16.8, 15.3, 15.0, 14.7, 13.8, 12.2, 11.1, 10.5, 7.1, 6.9, 4.9 77.0, 68.5, 34.3, 25.8, 25.2, 23.2, 19.0, 18.2, 18.0, 17.5, 17.2, 16.8, 15.3, 15.0, 14.7, 13.8, 12.2, 11.1, 10.5, 7.1, 6.9, 4.9 77.0, 68.5, 34.3, 19.0, 18.2, 17.5, 16.8, 15.3, 15.0, 13.8, 6.9 77.0, 68.5, 34.3, 19.0, 18.2, 17.5, 16.8, 15.3, 15.0, 13.8, 6.9 

Antibody dilution

1:250 1:270 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:500 1:2200   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 « 
 
UBC-001
 
UBC-003
 
UBC-007
 
UBC-008
 
UBC-009
 
UBC-011
 
UBC-012
 
UBC-013
 
UBC-014
 
UBC-015
 
UBC-016
 
UBC-201
 
 »