RPS27A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041344

 

Antibody HPA049132

 

Antibody CAB033319

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA041344 HPA049132 sc-53509 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

10 10 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

41 36  

Antigen sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
 
GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
 
 

Matching transcripts

RPS27A-001 - ENSP00000272317 [100%]
RPS27A-002 - ENSP00000385659 [100%]
RPS27A-003 - ENSP00000383981 [100%]
RPS27A-004 - ENSP00000408482 [100%]
 RPS27A-001 - ENSP00000272317 [97%]
RPS27A-002 - ENSP00000385659 [97%]
RPS27A-003 - ENSP00000383981 [97%]
RPS27A-004 - ENSP00000408482 [97%]
  

Other gene match

UBC - ENSG00000150991 [100%]
UBB - ENSG00000170315 [100%]
UBA52 - ENSG00000221983 [100%]
UBBP4 - ENSG00000263563 [100%]
 UBC - ENSG00000150991 [100%]
UBB - ENSG00000170315 [100%]
UBA52 - ENSG00000221983 [97%]
UBBP4 - ENSG00000263563 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human nasopharynx shows strong nuclear and cytoplasmic positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human nasopharynx shows nuclear positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:450 1:25000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

77.0, 68.5, 34.3, 25.8, 25.2, 23.2, 19.0, 18.2, 18.0, 17.5, 17.2, 16.8, 15.3, 15.0, 14.7, 13.8, 12.2, 11.1, 10.5, 7.1, 6.9, 4.9 77.0, 68.5, 34.3, 25.8, 25.2, 23.2, 19.0, 18.2, 18.0, 17.5, 17.2, 16.8, 15.3, 15.0, 14.7, 13.8, 12.2, 11.1, 10.5, 7.1, 6.9, 4.9 18.0, 12.2 

Antibody dilution

1:250 1:270 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:2200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
RPS27A-001
 
RPS27A-002
 
RPS27A-003
 
RPS27A-004