PDK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027376

 

Antibody CAB017554

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA027376 sc-28783 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

60  

Antigen sequence

KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDT
VIRIRNRHND
 
 

Matching transcripts

PDK1-001 - ENSP00000282077 [100%]
PDK1-002 - ENSP00000386985 [100%]
PDK1-004 - ENSP00000399558 [100%]
PDK1-007 - ENSP00000388366 [100%]
PDK1-201 - ENSP00000438567 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in subsets of renal tubules.
More information
 Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:30 1:300 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400922)
More information
  

Target mass (kDa)

49.2, 41.3, 17.8 51.6, 49.2, 41.3, 32.0, 26.3, 18.5, 17.8, 7.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PDK1-001
 
PDK1-002
 
PDK1-004
 
PDK1-007
 
PDK1-201