ANGPT1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018793

 

Antibody HPA018816

 

Antibody CAB017815

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA018793 HPA018816 2593.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

70 72  

Antigen sequence

EKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNL
CTKEGVLLKGGKREEEKPFR
 
SNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQR
DAPHVEPDFSSQKLQHLEHVME
 
 

Matching transcripts

ANGPT1-001 - ENSP00000428340 [100%]
ANGPT1-002 - ENSP00000430750 [100%]
ANGPT1-003 - ENSP00000297450 [99%]
ANGPT1-009 - ENSP00000429349 [99%]
 ANGPT1-001 - ENSP00000428340 [100%]
ANGPT1-003 - ENSP00000297450 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lung shows distinct cytoplasmic positivity in macrophages.
More information
 Immunohistochemical staining of human lung shows distinct cytoplasmic positivity in macrophages.
More information
 Immunohistochemical staining of human rectum shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:35 1:60 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.5, 34.3 57.5 57.5, 34.3, 3.3 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ANGPT1-001
 
ANGPT1-002
 
ANGPT1-003
 
ANGPT1-009