NCK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030766

 

Antibody CAB005063

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA030766 1622-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

150  

Antigen sequence

MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGF
VPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDP
GERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNG
 
 

Matching transcripts

NCK1-001 - ENSP00000288986 [100%]
NCK1-003 - ENSP00000417273 [100%]
NCK1-009 - ENSP00000417729 [89%]
NCK1-004 - ENSP00000419302 [86%]
NCK1-010 - ENSP00000419544 [81%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human testis shows strong nuclear positivity in primary spermatocytes in seminiferus ducts.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:150 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:67 1:37 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.9, 18.4, 16.1, 14.9 42.9, 35.5, 20.1, 18.4, 16.1, 14.9, 13.2, 8.8 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
NCK1-001
 
NCK1-003
 
NCK1-004
 
NCK1-009
 
NCK1-010