CUL4B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003046

 

Antibody HPA011880

 

Antibody CAB017786

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA003046 HPA011880 2515.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

2 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

104 144  

Antigen sequence

LAKSSTTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVE
AIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQF
REDS
 
GDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRK
LNSSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVA
ASSHVPIQKKLRFEDTLEFVGFDAKMAEESSSSSSSSSPTAATS
 
 

Matching transcripts

CUL4B-001 - ENSP00000384109 [100%]
CUL4B-003 - ENSP00000360373 [100%]
CUL4B-004 - ENSP00000338919 [100%]
 CUL4B-001 - ENSP00000384109 [100%]
CUL4B-003 - ENSP00000360373 [90%]
CUL4B-004 - ENSP00000338919 [90%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:69 1:65  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

104.0, 102.8, 102.3 104.0, 102.8, 102.3 104.0, 102.8, 102.3, 27.9 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
More information
 Immunohistochemical staining of human esophagus shows nuclear positivity in squamous epithelial cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:80 1:275 

Literature conformity

 Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Not done Not done 
 

ANTIGEN VIEW

? »
 
 
 
CUL4B-001
 
CUL4B-003
 
CUL4B-004