ATP13A2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050910

 

Antibody HPA054717

 

Antibody CAB037038

 

Antibody CAB037111

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 SIGMA
 

Product name

HPA050910 HPA054717 A9732 A9607 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity Affinity 

Released in version

14 14 14 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

83 88   

Antigen sequence

RGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAAS
YTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKV
 
EIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEG
AWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIET
 
 
 

Matching transcripts

ATP13A2-001 - ENSP00000327214 [100%]
ATP13A2-005 - ENSP00000413307 [100%]
 ATP13A2-001 - ENSP00000327214 [100%]
ATP13A2-009 - ENSP00000424313 [99%]
ATP13A2-002 - ENSP00000341115 [94%]
ATP13A2-005 - ENSP00000413307 [94%]
ATP13A2-008 - ENSP00000422227 [94%]
ATP13A2-010 - ENSP00000422668 [93%]
ATP13A2-011 - ENSP00000427241 [93%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells and islets of Langerhans.
More information
 Immunohistochemical staining of human nasopharynx shows strong cytoplasmic and nuclear positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:700 1:600 1:800 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data Not done Not done 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

128.8, 128.3 128.8, 128.3, 126.0, 36.0, 21.6, 21.5, 21.3 128.8, 128.3, 126.0, 42.6, 36.0, 28.1, 24.5, 21.6, 21.5, 21.3, 20.7 128.8, 128.3, 126.0, 42.6, 36.0, 28.1, 24.5, 21.6, 21.5, 21.3, 20.7 

Antibody dilution

1:1050 1:350 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:8400 1:2850   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
ATP13A2-001
 
ATP13A2-002
 
ATP13A2-005
 
ATP13A2-008
 
ATP13A2-009
 
ATP13A2-010
 
ATP13A2-011