ABCG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031470

 

Antibody HPA031471

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031470 HPA031471 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

69 71 

Antigen sequence

AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLP
RRAAVNIEFRDLSYSVPEG
 
EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRL
KGLRKDSSSMEGCHSFSASCL
 

Matching transcripts

ABCG1-001 - ENSP00000381467 [100%]
ABCG1-002 - ENSP00000381475 [100%]
ABCG1-004 - ENSP00000291524 [100%]
ABCG1-005 - ENSP00000339744 [100%]
ABCG1-006 - ENSP00000354995 [100%]
ABCG1-010 - ENSP00000414541 [100%]
 ABCG1-006 - ENSP00000354995 [100%]
ABCG1-008 - ENSP00000381464 [100%]
ABCG1-201 - ENSP00000343820 [100%]
ABCG1-001 - ENSP00000381467 [83%]
ABCG1-002 - ENSP00000381475 [83%]
ABCG1-004 - ENSP00000291524 [83%]
ABCG1-005 - ENSP00000339744 [83%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bronchus shows strong positivity in cilia of respiratory epithelial cells.
More information
 Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:150 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HeLa shows positivity in the Golgi apparatus, vesicles & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:137  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

75.6, 75.4, 74.6, 74.2, 74.0, 27.8 90.9, 86.8, 75.6, 75.4, 74.6, 74.2, 74.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABCG1-001
 
ABCG1-002
 
ABCG1-004
 
ABCG1-005
 
ABCG1-006
 
ABCG1-008
 
ABCG1-010
 
ABCG1-201