FGFR4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027273

 

Antibody HPA027369

 

Antibody HPA028251

 

Antibody CAB005196

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA027273 HPA027369 HPA028251 sc-124 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

6 6 6 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

55 61 68  

Antigen sequence

VEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPL
GSSSF
 
TGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGN
TVKFRCPAAGN
 
EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAP
AGRVRGWRGRLEIASFLP
 
 

Matching transcripts

FGFR4-001 - ENSP00000292408 [100%]
FGFR4-002 - ENSP00000377254 [100%]
FGFR4-003 - ENSP00000377259 [100%]
FGFR4-004 - ENSP00000424960 [100%]
FGFR4-201 - ENSP00000292410 [100%]
 FGFR4-001 - ENSP00000292408 [100%]
FGFR4-002 - ENSP00000377254 [100%]
FGFR4-003 - ENSP00000377259 [100%]
FGFR4-004 - ENSP00000424960 [100%]
FGFR4-010 - ENSP00000424905 [100%]
FGFR4-201 - ENSP00000292410 [100%]
 FGFR4-001 - ENSP00000292408 [100%]
FGFR4-002 - ENSP00000377254 [100%]
FGFR4-003 - ENSP00000377259 [100%]
FGFR4-004 - ENSP00000424960 [100%]
FGFR4-008 - ENSP00000422889 [100%]
FGFR4-010 - ENSP00000424905 [100%]
FGFR4-012 - ENSP00000426492 [100%]
FGFR4-201 - ENSP00000292410 [100%]
FGFR4-009 - ENSP00000427222 [91%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes
More information
 Immunohistochemical staining of human gall bladder shows strong cytoplasmic and membrane positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:75 1:35 1:35 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:50 1:50 1:20 1:40 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400735)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

88.0, 83.5, 80.5 88.0, 83.5, 80.5, 22.2 88.0, 83.5, 80.5, 22.2, 12.4, 11.8, 9.5 88.0, 83.5, 80.5, 30.3, 22.2, 12.4, 11.8, 9.5, 7.7 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FGFR4-001
 
FGFR4-002
 
FGFR4-003
 
FGFR4-004
 
FGFR4-008
 
FGFR4-009
 
FGFR4-010
 
FGFR4-012
 
FGFR4-201