PGLYRP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043568

 

Antibody HPA046311

 

Antibody CAB033468

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA043568 HPA046311 sc-50470 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

80 107  

Antigen sequence

VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPR
CRWGAAPYRGRPKLLQLPLGFLYVHHTYVP
 
LMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVR
EGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGD
TFPDVVA
 
 

Matching transcripts

PGLYRP2-001 - ENSP00000345968 [100%]
PGLYRP2-002 - ENSP00000292609 [100%]
 PGLYRP2-001 - ENSP00000345968 [100%]
PGLYRP2-002 - ENSP00000292609 [100%]
PGLYRP2-003 - ENSP00000472856 [86%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:15 1:175 1:225 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

68.0, 62.2 68.0, 62.2, 19.5 68.0, 62.2, 19.5, 11.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:12000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
PGLYRP2-001
 
PGLYRP2-002
 
PGLYRP2-003