IKZF3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024377

 

Antibody CAB017105

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA024377 2322 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

110  

Antigen sequence

AVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLK
SEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVC
GLSCISFNVL
 
 

Matching transcripts

IKZF3-001 - ENSP00000344544 [100%]
IKZF3-003 - ENSP00000345622 [100%]
IKZF3-004 - ENSP00000341977 [100%]
IKZF3-005 - ENSP00000344471 [100%]
IKZF3-006 - ENSP00000420463 [100%]
IKZF3-007 - ENSP00000463505 [100%]
IKZF3-008 - ENSP00000462791 [100%]
IKZF3-009 - ENSP00000367180 [100%]
IKZF3-015 - ENSP00000403027 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows distinct nuclear positivity in most cells.
More information
 Immunohistochemical staining of human kidney shows cytoplasmic and nuclear positivity of cells in both glomeruli and tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:2500 1:150 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:200 1:37 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

58.0, 53.7, 53.4, 51.6, 49.1, 47.0, 42.7, 30.0, 23.6 58.0, 54.4, 53.7, 53.4, 51.6, 49.8, 49.1, 48.0, 47.0, 42.7, 41.6, 36.9, 32.7, 30.0, 23.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:20000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
IKZF3-001
 
IKZF3-003
 
IKZF3-004
 
IKZF3-005
 
IKZF3-006
 
IKZF3-007
 
IKZF3-008
 
IKZF3-009
 
IKZF3-015