ACOX1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021192

 

Antibody HPA021195

 

Antibody HPA028759

 

Antibody CAB021094

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 GenWay Biotech
 

Product name

HPA021192 HPA021195 HPA028759 15-288-22819 

Host species

Rabbit Rabbit Rabbit Hen 

Clonality

pAb pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 5 6 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

89 97 116  

Antigen sequence

MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHED
LNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFK
 
AVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHR
INEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGY
 
VAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYS
LYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQ
DVTLGSVLGRYDGNVY
 
 

Matching transcripts

ACOX1-001 - ENSP00000293217 [100%]
ACOX1-002 - ENSP00000301608 [100%]
ACOX1-003 - ENSP00000458325 [100%]
ACOX1-012 - ENSP00000466210 [100%]
 ACOX1-001 - ENSP00000293217 [100%]
ACOX1-002 - ENSP00000301608 [100%]
ACOX1-201 - ENSP00000441257 [100%]
 ACOX1-001 - ENSP00000293217 [100%]
ACOX1-002 - ENSP00000301608 [100%]
ACOX1-201 - ENSP00000441257 [100%]
ACOX1-014 - ENSP00000468651 [97%]
ACOX1-009 - ENSP00000466921 [86%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:15 1:50 1:1200 

Literature conformity

Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Western Blot

Image

    

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

74.7, 74.4, 25.9, 18.2 74.7, 74.4, 70.1 74.7, 74.4, 70.1, 17.0, 14.9 74.7, 74.4, 70.1, 25.9, 18.2, 17.0, 14.9, 12.4, 7.8 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, vesicles & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & vesicles.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:200 1:5   

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.   

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:500 1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACOX1-001
 
ACOX1-002
 
ACOX1-003
 
ACOX1-009
 
ACOX1-012
 
ACOX1-014
 
ACOX1-201