BNIPL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019946

 

Antibody HPA023464

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019946 HPA023464 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

72 71 

Antigen sequence

STLALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSDLE
IDELETPSDSEQLDSGHEFEWE
 
MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPE
EAGTSEDPEDPKGDSQAAAGT
 

Matching transcripts

BNIPL-001 - ENSP00000357927 [100%]
BNIPL-006 - ENSP00000355333 [100%]
BNIPL-002 - ENSP00000295294 [86%]
BNIPL-003 - ENSP00000376550 [86%]
BNIPL-005 - ENSP00000435072 [86%]
 BNIPL-001 - ENSP00000357927 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human gall bladder shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human gall bladder shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:75 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

1:100 1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408738)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408738)
More information
 

Target mass (kDa)

39.7, 38.1, 31.0, 22.9, 11.0 39.7 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BNIPL-001
 
BNIPL-002
 
BNIPL-003
 
BNIPL-005
 
BNIPL-006