ALPP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038764

 

Antibody HPA038765

 

Antibody HPA051699

 

Antibody CAB026327

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA038764 HPA038765 HPA051699 MS-734 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

30 33 31  

Antigen sequence

NWYSDADVPASARQEGCQDIATQLISNMDI
 
HRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVE
 
FQTIGLSAAARFNQCNTTRGNEVISVMNRAK
 
 

Matching transcripts

ALPP-001 - ENSP00000375881 [100%]
 ALPP-001 - ENSP00000375881 [94%]
 ALPP-001 - ENSP00000375881 [100%]
  

Other gene match

ALPPL2 - ENSG00000163286 [100%]
ALPI - ENSG00000163295 [97%]
 ALPPL2 - ENSG00000163286 [91%]
ALPI - ENSG00000163295 [100%]
 ALPPL2 - ENSG00000163286 [100%]
ALPI - ENSG00000163295 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous staining in trophoblasts.
More information
 Immunohistochemical staining of human small intestine shows distinct membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows strong luminal membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:85 1:150 1:50 1:200 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.0, 57.4, 56.8 58.0, 57.4, 56.8 58.0, 57.4, 56.8 58.0 

Antibody dilution

1:250 1:250 1:90 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ALPP-001