IGFBP7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002196

 

Antibody CAB020668

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA002196 2979.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

101  

Antigen sequence

EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRT
ELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQ
A
 
 

Matching transcripts

IGFBP7-001 - ENSP00000295666 [100%]
IGFBP7-201 - ENSP00000444146 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:125 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

29.1, 28.9 29.1, 28.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in golgi apparatus.
More information
 

Antibody dilution

 1:31 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
IGFBP7-001
 
IGFBP7-201