GMPS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046630

 

Antibody HPA050682

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046630 HPA050682 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

140 137 

Antigen sequence

AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAF
AIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNK
VFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT
 
LAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTE
EDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWES
LIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTF
 

Matching transcripts

GMPS-001 - ENSP00000419851 [100%]
 GMPS-001 - ENSP00000419851 [100%]
GMPS-002 - ENSP00000295920 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:20  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.7 76.7, 65.9 

Antibody dilution

1:100 1:150 

Validation WB

Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:800 1:1200 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:250 

Literature conformity

 No avaliable characterization data 

RNA consistency

 Not done 
 

ANTIGEN VIEW

? »
 
 
 
GMPS-001
 
GMPS-002