APEH

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029700

 

Antibody HPA029701

 

Antibody HPA029702

 

Antibody HPA029703

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029700 HPA029701 HPA029702 HPA029703 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

87 91 88 93 

Antigen sequence

IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWG
IRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP
 
IARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGV
PENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSA
 
RQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGP
GEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCFGC
 
EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFK
QGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL
 

Matching transcripts

APEH-001 - ENSP00000296456 [100%]
APEH-002 - ENSP00000415862 [100%]
 APEH-001 - ENSP00000296456 [100%]
APEH-002 - ENSP00000415862 [100%]
APEH-003 - ENSP00000414369 [100%]
APEH-014 - ENSP00000402365 [100%]
 APEH-001 - ENSP00000296456 [100%]
APEH-002 - ENSP00000415862 [100%]
APEH-012 - ENSP00000410366 [100%]
 APEH-001 - ENSP00000296456 [100%]
APEH-002 - ENSP00000415862 [100%]
 

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:300 1:25 1:1600 1:250 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:100  1:50 1:100 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

81.7, 81.2 81.7, 81.2, 34.6, 26.0 81.7, 81.2, 31.9 81.7, 81.2 

Antibody dilution

1:250 1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
APEH-001
 
APEH-002
 
APEH-003
 
APEH-012
 
APEH-014