ACSL6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040470

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040470 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

111 

Antigen sequence

RYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKE
RGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTTGNPKGA
MLTHGNVVADF
 

Matching transcripts

ACSL6-001 - ENSP00000368566 [100%]
ACSL6-002 - ENSP00000368548 [100%]
ACSL6-003 - ENSP00000368557 [100%]
ACSL6-004 - ENSP00000368542 [100%]
ACSL6-005 - ENSP00000397507 [100%]
ACSL6-006 - ENSP00000415140 [100%]
ACSL6-008 - ENSP00000368546 [100%]
ACSL6-009 - ENSP00000296869 [100%]
ACSL6-201 - ENSP00000349608 [100%]
ACSL6-202 - ENSP00000368551 [100%]
ACSL6-204 - ENSP00000442124 [100%]
ACSL6-205 - ENSP00000445154 [100%]
ACSL6-018 - ENSP00000413329 [88%]
ACSL6-203 - ENSP00000368574 [88%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:300 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

80.6, 80.5, 79.1, 79.0, 77.8, 77.7, 75.2, 74.2, 69.2, 67.6, 40.8 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ACSL6-001
 
ACSL6-002
 
ACSL6-003
 
ACSL6-004
 
ACSL6-005
 
ACSL6-006
 
ACSL6-008
 
ACSL6-009
 
ACSL6-018
 
ACSL6-201
 
ACSL6-202
 
ACSL6-203
 
ACSL6-204
 
ACSL6-205
 
 »