CTSB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018156

 

Antibody CAB000457

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 AbD Serotec
 

Product name

HPA018156 AHP591 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

129  

Antigen sequence

DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTED
LKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNA
HVSVEVSAEDLLTCCGSMCGDGCNGGYPA
 
 

Matching transcripts

CTSB-001 - ENSP00000345672 [100%]
CTSB-002 - ENSP00000432244 [100%]
CTSB-003 - ENSP00000435105 [100%]
CTSB-004 - ENSP00000433215 [100%]
CTSB-005 - ENSP00000434217 [100%]
CTSB-006 - ENSP00000409917 [100%]
CTSB-007 - ENSP00000342070 [100%]
CTSB-015 - ENSP00000436159 [100%]
CTSB-017 - ENSP00000433995 [100%]
CTSB-019 - ENSP00000435074 [100%]
CTSB-202 - ENSP00000415889 [100%]
CTSB-020 - ENSP00000436627 [95%]
CTSB-018 - ENSP00000436122 [90%]
CTSB-021 - ENSP00000434725 [90%]
CTSB-027 - ENSP00000431518 [84%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells. Brunner's glands were also positive while Paneth cells were negative.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.
More information
 

Retrieval method

HIER pH6 None 

Antibody dilution

1:25 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 

Antibody dilution

1:22 1:50 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

37.8, 19.5, 18.9, 18.5, 16.6, 16.1, 15.4 37.8, 19.5, 18.9, 18.5, 16.6, 16.1, 15.4, 12.7, 11.8, 11.4, 10.7, 8.6, 8.1, 7.8, 6.5, 3.7, 2.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:10000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 « 
 
CTSB-001
 
CTSB-002
 
CTSB-003
 
CTSB-004
 
CTSB-005
 
CTSB-006
 
CTSB-007
 
CTSB-015
 
CTSB-017
 
CTSB-018
 
CTSB-019
 
CTSB-020
 
CTSB-021
 
CTSB-027
 
CTSB-202
 
 »