MAPK7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031031

 

Antibody CAB018561

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA031031 sc-5626 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

84  

Antigen sequence

DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQP
SLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA
 
 

Matching transcripts

MAPK7-001 - ENSP00000378966 [100%]
MAPK7-002 - ENSP00000378968 [100%]
MAPK7-003 - ENSP00000299612 [100%]
MAPK7-201 - ENSP00000311005 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:50 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

1:48 1:13 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

88.4, 73.2 88.4, 73.2, 27.2, 22.6, 17.2, 15.6, 8.4 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MAPK7-001
 
MAPK7-002
 
MAPK7-003
 
MAPK7-201