AXL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037422

 

Antibody HPA037423

 

Antibody CAB032501

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA037422 HPA037423 sc-20741 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

7 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

91 74  

Antigen sequence

PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHW
QEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
 
ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQ
TQVPLGEDEQDDWIVVSQLRITSL
 
 

Matching transcripts

AXL-001 - ENSP00000301178 [100%]
AXL-002 - ENSP00000351995 [100%]
AXL-004 - ENSP00000471497 [100%]
 AXL-001 - ENSP00000301178 [100%]
AXL-002 - ENSP00000351995 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:50 1:75 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in intermediate filaments.
More information
 Application not done for this antibody. 

Antibody dilution

 1:43  

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411883)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411883)
More information
  

Target mass (kDa)

98.3, 97.4, 69.2 98.3, 97.4 98.3, 97.4, 69.2 

Antibody dilution

1:250 1:125 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AXL-001
 
AXL-002
 
AXL-004