STAT3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001671

 

Antibody HPA058603

 

Antibody CAB003859

 

Antibody CAB068241

 

Antibody CAB068242

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Epitomics
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA001671 HPA058603 1122-1 AMAb90777 AMAb90776 

Host species

Rabbit Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant Protein A/G Protein A/G 

Released in version

2 13 2 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide Recombinant protein Recombinant protein 

Length (aa)

149 138    

Antigen sequence

GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILV
SPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTT
CSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECA
 
EKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLE
QHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSV
TRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQK
 
 
 
 

Matching transcripts

STAT3-001 - ENSP00000264657 [100%]
STAT3-011 - ENSP00000467985 [100%]
STAT3-013 - ENSP00000373923 [100%]
STAT3-002 - ENSP00000384943 [99%]
 STAT3-001 - ENSP00000264657 [100%]
STAT3-002 - ENSP00000384943 [100%]
STAT3-011 - ENSP00000467985 [100%]
STAT3-012 - ENSP00000467000 [100%]
STAT3-013 - ENSP00000373923 [98%]
    

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human lung shows distinct nuclear positivity in pneumocytes.
More information
 Immunohistochemical staining of human small intestine shows strong positivity in glandular cells.
More information
 Immunohistochemical staining of human lung shows distinct nuclear positivity in pneumocytes.
More information
 Immunohistochemical staining of human liver shows strong positivity in hepatocytes.
More information
 Immunohistochemical staining of human small intestine shows moderate cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:100 1:75 1:1200 1:150 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Not done Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:15     

Validation IF

Supportive: The subcellular location is supported by literature.     

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

88.1, 88.0, 76.1 88.1, 88.0, 83.1, 76.1 88.1, 88.0, 83.1, 76.1, 10.2 88.1, 88.0, 83.1, 76.1, 10.2 88.1, 88.0, 83.1, 76.1, 10.2 

Antibody dilution

1:250 1:110 1:500 1:500 1:1000 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:1000 1:1200    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
STAT3-001
 
STAT3-002
 
STAT3-011
 
STAT3-012
 
STAT3-013