NPNT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003711

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003711 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

138 

Antigen sequence

RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYN
VRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGN
NNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK
 

Matching transcripts

NPNT-001 - ENSP00000369323 [99%]
NPNT-002 - ENSP00000402884 [99%]
NPNT-003 - ENSP00000389252 [99%]
NPNT-004 - ENSP00000422044 [99%]
NPNT-005 - ENSP00000302557 [99%]
NPNT-006 - ENSP00000422474 [99%]
NPNT-008 - ENSP00000427507 [99%]
NPNT-009 - ENSP00000426146 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

66.9, 65.2, 64.0, 62.0, 61.9, 58.7, 55.7, 49.8 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NPNT-001
 
NPNT-002
 
NPNT-003
 
NPNT-004
 
NPNT-005
 
NPNT-006
 
NPNT-008
 
NPNT-009