FEM1B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041920

 

Antibody HPA042192

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041920 HPA042192 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

88 90 

Antigen sequence

NDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNP
QELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIY
 
RFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNA
MDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIH
 

Matching transcripts

FEM1B-001 - ENSP00000307298 [100%]
 FEM1B-001 - ENSP00000307298 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows moderate nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:350 1:50 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:200  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414619)
More information
 

Target mass (kDa)

70.3 70.3 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FEM1B-001