MTM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010008

 

Antibody HPA010665

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA010008 HPA010665 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

132 131 

Antigen sequence

KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYR
ASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDD
EKYLDVIRETNKQISKLTIYDARPSVNAVANK
 
LDHLYSCRFGTFLFNCESARERQKVTERTVSLWSLINSNKEKFKNPFYTK
EINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDE
YIKRLEELQLANSAKLSDPPTSPSSPSQMMP
 

Matching transcripts

MTM1-002 - ENSP00000359423 [100%]
MTM1-201 - ENSP00000389157 [100%]
MTM1-202 - ENSP00000444015 [100%]
MTM1-203 - ENSP00000439784 [100%]
 MTM1-002 - ENSP00000359423 [100%]
MTM1-201 - ENSP00000389157 [100%]
MTM1-203 - ENSP00000439784 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells (goblet cells).
More information
 Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:15 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane.
More information
 Application not done for this antibody. 

Antibody dilution

1:61  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

69.9, 66.1, 57.2, 48.2 69.9, 66.1, 57.2 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MTM1-002
 
MTM1-201
 
MTM1-202
 
MTM1-203