FUT3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046966

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046966 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

36 

Antigen sequence

KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL
 

Matching transcripts

FUT3-001 - ENSP00000468123 [100%]
FUT3-002 - ENSP00000305603 [100%]
FUT3-003 - ENSP00000465804 [100%]
FUT3-004 - ENSP00000416443 [100%]
 

Other gene match

FUT5 - ENSG00000130383 [97%]
FUT6 - ENSG00000156413 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

43.0, 42.2, 42.1, 41.9 

Antibody dilution

1:100 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1150 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FUT3-001
 
FUT3-002
 
FUT3-003
 
FUT3-004