SOCS5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020884

 

Antibody CAB025510

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA020884 AF4796 

Host species

Rabbit Goat 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

133  

Antigen sequence

HLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPP
NAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTT
LCLQSRRQKQRQISGDSHTHVSRQGAWKVHTQI
 
 

Matching transcripts

SOCS5-001 - ENSP00000305133 [100%]
SOCS5-002 - ENSP00000378330 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:10 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:10  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

61.2 61.2 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SOCS5-001
 
SOCS5-002