OXSR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008237

 

Antibody CAB017181

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Kazusa DNA Research Institute
 

Product name

HPA008237 GX0419 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

111  

Antigen sequence

FDEESEEGKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHL
PQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRN
SKKELNDIRFE
 
 

Matching transcripts

OXSR1-001 - ENSP00000311713 [100%]
OXSR1-004 - ENSP00000415851 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in keratinocytes.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:80 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:25  

Validation IF

Supportive: The subcellular location is supported by literature.  

         siRNA

Image

  

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. 

Antibody dilution

1:26  

Validation siRNA

Supportive: The siRNA validation is supportive.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.0, 51.9 58.0, 51.9, 12.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
OXSR1-001
 
OXSR1-004