ABLIM3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003245

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003245 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

146 

Antigen sequence

DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARR
FSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSS
REALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT
 

Matching transcripts

ABLIM3-001 - ENSP00000310309 [100%]
ABLIM3-002 - ENSP00000425394 [100%]
ABLIM3-004 - ENSP00000421183 [100%]
ABLIM3-005 - ENSP00000420855 [100%]
ABLIM3-006 - ENSP00000315841 [100%]
ABLIM3-201 - ENSP00000348938 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

77.8, 74.2, 67.1, 61.6 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABLIM3-001
 
ABLIM3-002
 
ABLIM3-004
 
ABLIM3-005
 
ABLIM3-006
 
ABLIM3-201