C1QA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002350

 

Antibody CAB009823

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA002350 sc-25856 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

134  

Antigen sequence

GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVC
TVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSG
GMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS
 
 

Matching transcripts

C1QA-001 - ENSP00000363773 [100%]
C1QA-003 - ENSP00000385564 [100%]
C1QA-002 - ENSP00000416841 [88%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human stomach shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:75 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not at all consistent with RNAseq data Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & the Golgi apparatus.
More information
 Application not done for this antibody. 

Antibody dilution

1:20  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414262)
More information
  

Target mass (kDa)

26.0, 23.4 26.0, 23.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
C1QA-001
 
C1QA-002
 
C1QA-003