SLC38A9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043785

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043785 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

101 

Antigen sequence

NSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVI
QRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSA
Y
 

Matching transcripts

SLC38A9-001 - ENSP00000380074 [100%]
SLC38A9-006 - ENSP00000423219 [100%]
SLC38A9-010 - ENSP00000425055 [100%]
SLC38A9-201 - ENSP00000316596 [100%]
SLC38A9-203 - ENSP00000437771 [100%]
SLC38A9-012 - ENSP00000422843 [92%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1600 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:109 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.8, 52.7, 51.9, 14.9, 11.0 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SLC38A9-001
 
SLC38A9-006
 
SLC38A9-010
 
SLC38A9-012
 
SLC38A9-201
 
SLC38A9-203