CD163

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046404

 

Antibody HPA051974

 

Antibody CAB002432

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA046404 HPA051974 NCL-CD163 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

14 14 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

71 65  

Antigen sequence

SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKF
LPISGMEKEAILSHTEKENGN
 
ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGK
HYCNHNEDAGVTCSD
 
 

Matching transcripts

CD163-001 - ENSP00000352071 [100%]
 CD163-001 - ENSP00000352071 [98%]
CD163-002 - ENSP00000403885 [98%]
CD163-003 - ENSP00000379863 [98%]
CD163-005 - ENSP00000444071 [98%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in Kupffer cells.
More information
 Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
More information
 Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1600 1:300 1:100 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

125.4 125.4, 124.9, 121.6, 120.3 125.4, 124.9, 121.6, 120.3, 15.0, 13.4 

Antibody dilution

1:250 1:130 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000 1:1100  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD163-001
 
CD163-002
 
CD163-003
 
CD163-005