ATP6AP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003156

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003156 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

138 

Antigen sequence

NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLD
EIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFD
TSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
 

Matching transcripts

ATP6AP2-004 - ENSP00000367697 [100%]
ATP6AP2-201 - ENSP00000438415 [100%]
ATP6AP2-203 - ENSP00000440459 [100%]
ATP6AP2-202 - ENSP00000441536 [94%]
ATP6AP2-006 - ENSP00000410105 [90%]
ATP6AP2-001 - ENSP00000411317 [83%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells and in cells of granular layer.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:35 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
 

Antibody dilution

1:25 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417089)
More information
 

Target mass (kDa)

39.0, 35.6, 30.9, 30.3, 28.7, 26.5 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ATP6AP2-001
 
ATP6AP2-004
 
ATP6AP2-006
 
ATP6AP2-201
 
ATP6AP2-202
 
ATP6AP2-203