ACTG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041264

 

Antibody HPA041271

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041264 HPA041271 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

26 37 

Antigen sequence

PKANREKMTQIMFETFNTPAMYVAIQ
 
MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
 

Matching transcripts

ACTG1-001 - ENSP00000331514 [100%]
ACTG1-002 - ENSP00000459124 [100%]
ACTG1-003 - ENSP00000458435 [100%]
ACTG1-006 - ENSP00000461672 [100%]
ACTG1-010 - ENSP00000459119 [100%]
ACTG1-011 - ENSP00000460464 [100%]
ACTG1-012 - ENSP00000458162 [100%]
ACTG1-013 - ENSP00000460660 [100%]
ACTG1-017 - ENSP00000461407 [100%]
 ACTG1-001 - ENSP00000331514 [100%]
ACTG1-002 - ENSP00000459124 [100%]
ACTG1-003 - ENSP00000458435 [100%]
ACTG1-006 - ENSP00000461672 [100%]
ACTG1-010 - ENSP00000459119 [100%]
ACTG1-011 - ENSP00000460464 [100%]
ACTG1-012 - ENSP00000458162 [100%]
ACTG1-013 - ENSP00000460660 [100%]
ACTG1-014 - ENSP00000466346 [100%]
ACTG1-015 - ENSP00000462823 [100%]
ACTG1-017 - ENSP00000461407 [81%]
 

Other gene match

ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [96%]
ACTA1 - ENSG00000143632 [96%]
ACTC1 - ENSG00000159251 [96%]
ACTG2 - ENSG00000163017 [96%]
ACTBL2 - ENSG00000169067 [92%]
POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
POTEJ - ENSG00000222038 [100%]
 ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [97%]
ACTA1 - ENSG00000143632 [97%]
ACTC1 - ENSG00000159251 [97%]
ACTG2 - ENSG00000163017 [97%]
ACTBL2 - ENSG00000169067 [92%]
POTEE - ENSG00000188219 [84%]
POTEF - ENSG00000196604 [84%]
POTEI - ENSG00000196834 [84%]
POTEJ - ENSG00000222038 [84%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1800 1:150 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 37.1, 26.9, 23.8, 18.0, 16.8 121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 32.3, 26.9, 23.8, 21.8, 18.0, 16.8, 16.3, 14.5, 13.9, 13.0, 11.4, 11.0, 8.5 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ACTG1-001
 
ACTG1-002
 
ACTG1-003
 
ACTG1-006
 
ACTG1-010
 
ACTG1-011
 
ACTG1-012
 
ACTG1-013
 
ACTG1-014
 
ACTG1-015
 
ACTG1-017
 
 »