PRKD1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029834

 

Antibody CAB018367

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA029834 sc-638 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

6 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

60  

Antigen sequence

RELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETE
ETEMKALGER
 
 

Matching transcripts

PRKD1-001 - ENSP00000333568 [100%]
PRKD1-002 - ENSP00000390535 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells.
More information
 Immunohistochemical staining of human stomach shows distinct cytoplasmic and slightly weaker nuclear positivity in parietal cells of gastric glands.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:75 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

102.5, 101.7 102.5, 101.7, 17.2, 13.2, 9.2 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in plasma membrane & cytoplasm.
More information
  

Antibody dilution

1:200  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PRKD1-001
 
PRKD1-002