PBX1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003505

 

Antibody HPA003881

 

Antibody CAB018768

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA003505 HPA003881 sc-28313 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

113 144  

Antigen sequence

PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTIT
DQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQ
LMRLDNMLLAEGV
 
YSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEA
NIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQS
LNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSP
 
 

Matching transcripts

PBX1-001 - ENSP00000405890 [100%]
PBX1-002 - ENSP00000356872 [100%]
PBX1-007 - ENSP00000341455 [100%]
PBX1-012 - ENSP00000453188 [100%]
PBX1-201 - ENSP00000384856 [100%]
PBX1-202 - ENSP00000439943 [100%]
 PBX1-001 - ENSP00000405890 [100%]
PBX1-017 - ENSP00000452727 [100%]
PBX1-202 - ENSP00000439943 [100%]
PBX1-203 - ENSP00000440869 [100%]
  

Other gene match

 PBX3 - ENSG00000167081 [81%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in cortical cells.
More information
 Immunohistochemical staining of human fallopian tube shows nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:50 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
  Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:40  1:13 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400918)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.6, 46.3, 38.4, 37.0, 18.2 47.2, 46.6, 46.3, 39.2, 35.2, 33.0, 27.8 46.6, 46.3, 38.4, 37.0, 35.2, 33.0, 18.2, 17.6, 15.6, 14.3, 10.5, 7.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PBX1-001
 
PBX1-002
 
PBX1-007
 
PBX1-012
 
PBX1-017
 
PBX1-201
 
PBX1-202
 
PBX1-203