CD55

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002190

 

Antibody HPA024386

 

Antibody CAB010454

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA002190 HPA024386 sc-9156 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 5 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

155 149  

Antigen sequence

YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDE
GEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTP
NAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGT
LVTMG
 
PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSD
IEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSL
SPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
 
 

Matching transcripts

CD55-001 - ENSP00000356031 [100%]
CD55-002 - ENSP00000375788 [100%]
CD55-003 - ENSP00000356030 [90%]
CD55-009 - ENSP00000316333 [90%]
CD55-007 - ENSP00000433984 [89%]
CD55-201 - ENSP00000356029 [88%]
CD55-202 - ENSP00000356032 [88%]
CD55-204 - ENSP00000375787 [88%]
 CD55-001 - ENSP00000356031 [100%]
CD55-003 - ENSP00000356030 [100%]
CD55-007 - ENSP00000433984 [100%]
CD55-008 - ENSP00000340631 [100%]
CD55-009 - ENSP00000316333 [100%]
CD55-201 - ENSP00000356029 [100%]
CD55-202 - ENSP00000356032 [100%]
CD55-204 - ENSP00000375787 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lung shows strong membranous and cytoplasmic positivity in alveolar cells and macrophages.
More information
 Immunohistochemical staining of human lung shows strong membranous positivity in alveolar cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:75 1:35 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus.
More information
  Immunofluorescent staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
More information
 

Antibody dilution

1:30  1:40 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

49.3, 48.7, 48.5, 41.9, 41.4, 41.2, 39.8, 34.0 49.3, 48.7, 48.5, 41.9, 41.4, 41.2, 39.8, 35.7 49.3, 48.7, 48.5, 41.9, 41.4, 41.2, 39.8, 35.7, 34.0, 14.3 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD55-001
 
CD55-002
 
CD55-003
 
CD55-007
 
CD55-008
 
CD55-009
 
CD55-201
 
CD55-202
 
CD55-204