TCF4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA025958

 

Antibody CAB020722

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA025958 3036.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

107  

Antigen sequence

HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLL
PNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDE
GDENLQD
 
 

Matching transcripts

TCF4-001 - ENSP00000455984 [100%]
TCF4-002 - ENSP00000348374 [100%]
TCF4-003 - ENSP00000440731 [100%]
TCF4-004 - ENSP00000381382 [100%]
TCF4-005 - ENSP00000455346 [100%]
TCF4-006 - ENSP00000457649 [100%]
TCF4-007 - ENSP00000445202 [100%]
TCF4-008 - ENSP00000455135 [100%]
TCF4-009 - ENSP00000439656 [100%]
TCF4-010 - ENSP00000455179 [100%]
TCF4-011 - ENSP00000441562 [100%]
TCF4-012 - ENSP00000454647 [100%]
TCF4-013 - ENSP00000439827 [100%]
TCF4-015 - ENSP00000409447 [100%]
TCF4-016 - ENSP00000457765 [100%]
TCF4-019 - ENSP00000457263 [100%]
TCF4-041 - ENSP00000455418 [100%]
TCF4-042 - ENSP00000455261 [100%]
TCF4-044 - ENSP00000455763 [100%]
TCF4-045 - ENSP00000456125 [100%]
TCF4-046 - ENSP00000454366 [100%]
TCF4-201 - ENSP00000346440 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows distinct nuclear positivity in seminiferus duct cells.
More information
 Immunohistochemical staining of human testis shows distinct nuclear positivity in seminiferus duct cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:60 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:15 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

83.4, 72.4, 71.8, 71.3, 71.2, 69.1, 68.6, 68.5, 67.0, 65.3, 64.8, 64.6, 64.1, 57.4, 54.6, 54.2, 54.1 83.4, 72.4, 71.8, 71.3, 71.2, 69.1, 68.6, 68.5, 67.0, 65.3, 64.8, 64.6, 64.1, 57.4, 54.6, 54.2, 54.1, 29.7, 28.4, 22.3, 18.0, 17.7, 17.6, 16.9, 16.5, 15.4, 14.8, 14.5, 13.2, 12.8, 12.1, 11.7, 10.5, 6.1, 6.0, 5.9, 4.5 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
TCF4-001
 
TCF4-002
 
TCF4-003
 
TCF4-004
 
TCF4-005
 
TCF4-006
 
TCF4-007
 
TCF4-008
 
TCF4-009
 
TCF4-010
 
TCF4-011
 
TCF4-012
 
TCF4-013
 
TCF4-015
 
TCF4-016
 
TCF4-019
 
TCF4-041
 
TCF4-042
 
TCF4-044
 
TCF4-045
 
TCF4-046
 
TCF4-201
 
 »