MYH6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001239

 

Antibody HPA001349

 

Antibody CAB075723

 

Antibody CAB075724

 

Antibody CAB075725

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001239 HPA001349 AMAb90947 AMAb90948 AMAb90950 

Host species

Rabbit Rabbit Mouse Mouse Mouse 

Clonality

pAb pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G Protein A/G 

Released in version

1 1 14 14 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

145 143    

Antigen sequence

ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIK
AKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQ
LDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
 
QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLK
LTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKE
NQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
 
 
 
 

Matching transcripts

MYH6-001 - ENSP00000348634 [90%]
MYH6-201 - ENSP00000386041 [90%]
 MYH6-001 - ENSP00000348634 [100%]
MYH6-201 - ENSP00000386041 [100%]
    

Other gene match

MYH7 - ENSG00000092054 [100%]
 MYH7 - ENSG00000092054 [87%]
MYH1 - ENSG00000109061 [81%]
MYH2 - ENSG00000125414 [82%]
MYH8 - ENSG00000133020 [80%]
MYH4 - ENSG00000264424 [80%]
    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in a subset of myocytes.
More information
 Immunohistochemical staining of human heart muscle shows cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:250 1:5000 1:5000 1:10000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data 

         Western Blot

Image

     

Description

     

Target mass (kDa)

223.7, 223.1 223.7, 223.1, 223.0, 222.8 223.7 223.7 223.7 

Antibody dilution

1:500 1:500 1:500 1:500 1:500 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:2000 1:1000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
MYH6-001
 
MYH6-201