MYH6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001239

 

Antibody HPA001349

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001239 HPA001349 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

145 143 

Antigen sequence

ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIK
AKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQ
LDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
 
QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLK
LTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKE
NQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
 

Matching transcripts

MYH6-001 - ENSP00000348634 [90%]
MYH6-201 - ENSP00000386041 [90%]
 MYH6-001 - ENSP00000348634 [100%]
MYH6-201 - ENSP00000386041 [100%]
 

Other gene match

MYH7 - ENSG00000092054 [100%]
 MYH7 - ENSG00000092054 [87%]
MYH1 - ENSG00000109061 [81%]
MYH2 - ENSG00000125414 [82%]
MYH8 - ENSG00000133020 [80%]
MYH4 - ENSG00000264424 [80%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in a subset of myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:250 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm, focal adhesion sites & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:20  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

223.7, 223.1 223.7, 223.1, 223.0, 222.8 

Antibody dilution

1:500 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MYH6-001
 
MYH6-201