MB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003123

 

Antibody CAB000060

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA003123 M-7773 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

124  

Antigen sequence

DGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSED
EMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKY
LEFISECIIQVLQSKHPGDFGADA
 
 

Matching transcripts

MB-001 - ENSP00000380489 [100%]
MB-003 - ENSP00000403351 [100%]
MB-004 - ENSP00000384239 [100%]
MB-201 - ENSP00000352835 [100%]
MB-202 - ENSP00000380491 [100%]
MB-007 - ENSP00000397944 [82%]
MB-008 - ENSP00000389263 [82%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic and nuclear positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 None 

Antibody dilution

1:100 1:1500 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404319)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

17.2, 16.0, 11.9 17.2, 16.0, 11.9, 10.9, 8.6, 8.1 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MB-001
 
MB-003
 
MB-004
 
MB-007
 
MB-008
 
MB-201
 
MB-202