BAZ1A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002730

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002730 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

135 

Antigen sequence

RGHRESALKETLLQEKSRICAQLARFSEEKFHFSDKPQPDSKPTYSRGRS
SNAYDPSQMCAEKQLELRLRDFLLDIEDRIYQGTLGAIKVTDRHIWRSAL
ESGRYELLSEENKENGIIKTVNEDVEEMEIDEQTK
 

Matching transcripts

BAZ1A-001 - ENSP00000371859 [100%]
BAZ1A-002 - ENSP00000351555 [100%]
BAZ1A-201 - ENSP00000353458 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in endoplasmic reticulum.
More information
 

Antibody dilution

1:69 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

178.7, 175.4 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BAZ1A-001
 
BAZ1A-002
 
BAZ1A-201