HLA-DRA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050162

 

Antibody HPA053176

 

Antibody CAB002798

 

Antibody CAB015402

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Chemicon
 Santa Cruz Biotechnology
 

Product name

HPA050162 HPA053176 CBL120 sc-53319 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

13 13 2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Not known 

Length (aa)

26 40   

Antigen sequence

LEIMTKRSNYTPITNVPPEVTVLTNS
 
AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK
 
 
 

Matching transcripts

HLA-DRA-001 - ENSP00000378786 [100%]
 HLA-DRA-001 - ENSP00000378786 [100%]
HLA-DRA-002 - ENSP00000364121 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal and non-germinal center cells.
More information
 Immunohistochemical staining of human tonsil shows cytoplasmic positivity in leukocytes.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in both reaction center cells and lymphoid cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:400 1:250 1:1600 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

28.6 28.6, 25.9 28.6, 25.9 28.6, 25.9 

Antibody dilution

1:80 1:80 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:600 1:500   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
HLA-DRA-001
 
HLA-DRA-002