ITSN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018007

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018007 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

100 

Antigen sequence

ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPAS
LKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
 

Matching transcripts

ITSN1-001 - ENSP00000370719 [100%]
ITSN1-002 - ENSP00000370691 [100%]
ITSN1-023 - ENSP00000382301 [100%]
ITSN1-024 - ENSP00000382289 [100%]
ITSN1-025 - ENSP00000382290 [100%]
ITSN1-202 - ENSP00000370685 [100%]
ITSN1-205 - ENSP00000387377 [100%]
ITSN1-003 - ENSP00000382286 [80%]
ITSN1-037 - ENSP00000382292 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane.
More information
 

Antibody dilution

1:200 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

195.4, 194.8, 188.4, 137.6, 137.0, 133.6, 130.0, 129.4 

Antibody dilution

1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:20000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ITSN1-001
 
ITSN1-002
 
ITSN1-003
 
ITSN1-023
 
ITSN1-024
 
ITSN1-025
 
ITSN1-037
 
ITSN1-202
 
ITSN1-205