CSNK1E

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026288

 

Antibody CAB009626

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA026288 sc-25423 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

5 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

74  

Antigen sequence

NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANR
LRSAAEPVASTPASRIQPAGNTSP
 
 

Matching transcripts

CSNK1E-001 - ENSP00000383067 [100%]
CSNK1E-002 - ENSP00000384074 [100%]
CSNK1E-003 - ENSP00000352929 [100%]
CSNK1E-016 - ENSP00000403610 [100%]
CSNK1E-201 - ENSP00000380044 [100%]
CSNK1E-006 - ENSP00000400494 [89%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic and membrane positivity in glandular cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in cortical cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:60 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

47.3, 15.9, 12.9 47.3, 38.4, 36.1, 31.2, 25.6, 15.9, 12.9, 12.2, 9.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CSNK1E-001
 
CSNK1E-002
 
CSNK1E-003
 
CSNK1E-006
 
CSNK1E-016
 
CSNK1E-201