AMACR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019527

 

Antibody HPA020912

 

Antibody CAB001809

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA019527 HPA020912 M3616 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

7 7 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

75 84  

Antigen sequence

HNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEF
GFSREEIYQLNSDKIIESNKVKASL
 
APFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPE
MKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTF
 
 

Matching transcripts

AMACR-001 - ENSP00000334424 [100%]
AMACR-003 - ENSP00000424351 [100%]
AMACR-008 - ENSP00000371517 [93%]
 AMACR-001 - ENSP00000334424 [99%]
AMACR-003 - ENSP00000424351 [99%]
AMACR-008 - ENSP00000371517 [99%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in subsets of renal tubuli.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:5000 1:250 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & vesicles.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:400 1:100 1:25 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

43.9, 42.4, 40.7 43.9, 42.4, 40.7 43.9, 42.4, 40.7, 25.9, 22.2 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AMACR-001
 
AMACR-003
 
AMACR-008