INS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004932

 

Antibody CAB000048

 

Antibody CAB012098

 

Antibody CAB053843

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 BioGenex
 Abcam plc
 AbD Serotec
 

Product name

HPA004932 MU029-UC ab14181 5329-3816 

Host species

Rabbit Mouse Rabbit Mouse 

Clonality

pAb mAb msAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Affinity Affinity 

Released in version

4 1 4 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Synthetic peptide Recombinant protein 

Length (aa)

77    

Antigen sequence

SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLAL
EGSLQKRGIVEQCCTSICSLYQLENYC
 
 
 
 

Matching transcripts

INS-001 - ENSP00000370731 [100%]
INS-002 - ENSP00000250971 [100%]
INS-003 - ENSP00000380432 [100%]
INS-006 - ENSP00000424008 [84%]
    

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human pancreas shows cytoplasmic positivity in islets of Langerhans.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
More information
 

Retrieval method

HIER pH6 None HIER pH6 HIER pH6 

Antibody dilution

1:750 1:1000 1:3000 1:600 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Mainly consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400078)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

12.0, 11.0 12.0, 11.0, 10.6 12.0, 11.0, 10.6 12.0, 11.0, 10.6 

Antibody dilution

1:250 1:500  1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Target too small/large to be analyzed with the present setup Uncertain: No bands detected 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
INS-001
 
INS-002
 
INS-003
 
INS-006