CFLAR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019044

 

Antibody CAB022157

 

Antibody CAB025216

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Upstate
 R&D Systems
 

Product name

HPA019044 06-864 AF821 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Affinity 

Released in version

7 5 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

106   

Antigen sequence

IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDL
AELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLD
KSDVSS
 
 
 

Matching transcripts

CFLAR-001 - ENSP00000312455 [100%]
CFLAR-003 - ENSP00000339335 [100%]
CFLAR-005 - ENSP00000378580 [100%]
CFLAR-006 - ENSP00000345807 [100%]
CFLAR-007 - ENSP00000342809 [100%]
CFLAR-008 - ENSP00000399420 [100%]
CFLAR-009 - ENSP00000398551 [100%]
CFLAR-010 - ENSP00000406775 [100%]
CFLAR-011 - ENSP00000411535 [100%]
CFLAR-015 - ENSP00000411897 [100%]
CFLAR-018 - ENSP00000412882 [100%]
CFLAR-201 - ENSP00000339326 [100%]
CFLAR-202 - ENSP00000347757 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human small intestine shows distinct positivity of the brush border in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:45 1:60 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:154 1:11 1:15 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

55.3, 52.6, 51.3, 34.3, 33.3, 28.6, 27.9, 25.4, 15.0, 13.7 55.3, 52.6, 51.3, 44.1, 41.3, 34.3, 33.3, 28.6, 27.9, 25.4, 19.1, 15.0, 13.7, 13.3, 13.2, 7.4, 7.1 55.3, 52.6, 51.3, 44.1, 41.3, 34.3, 33.3, 28.6, 27.9, 25.4, 19.1, 15.0, 13.7, 13.3, 13.2, 7.4, 7.1 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 « 
 
CFLAR-001
 
CFLAR-003
 
CFLAR-005
 
CFLAR-006
 
CFLAR-007
 
CFLAR-008
 
CFLAR-009
 
CFLAR-010
 
CFLAR-011
 
CFLAR-015
 
CFLAR-018
 
CFLAR-201
 
CFLAR-202
 
 »