CD44

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005785

 

Antibody CAB000112

 

Antibody CAB000316

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 DakoCytomation
 

Product name

HPA005785 MAB4073 M7082 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Supernatant 

Released in version

3 2 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Not known 

Length (aa)

138   

Antigen sequence

DDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLM
STSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAG
WEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPR
 
 
 

Matching transcripts

CD44-001 - ENSP00000398632 [100%]
CD44-202 - ENSP00000414567 [100%]
CD44-203 - ENSP00000403990 [100%]
CD44-204 - ENSP00000391008 [100%]
CD44-028 - ENSP00000436623 [96%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human esophagus shows strong cytoplasmic and membranous positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human skin shows strong cytoplasmic and membranous positivity in epidermal cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 HIER pH9 

Antibody dilution

1:300 1:500 1:100 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & the Golgi apparatus.
More information
 

Antibody dilution

1:31 1:400 1:100 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

81.5, 78.5, 76.7, 74.4, 26.7 81.5, 78.5, 76.7, 76.6, 74.4, 53.4, 46.6, 43.2, 39.4, 37.3, 31.9, 31.0, 27.3, 26.7, 26.0, 25.7, 24.7, 22.7, 21.5, 21.2, 21.1, 21.0, 20.1, 19.5, 15.6, 13.5, 9.1, 8.9, 8.8 81.5, 78.5, 76.7, 76.6, 74.4, 53.4, 46.6, 43.2, 39.4, 37.3, 31.9, 31.0, 27.3, 26.7, 26.0, 25.7, 24.7, 22.7, 21.5, 21.2, 21.1, 21.0, 20.1, 19.5, 15.6, 13.5, 9.1, 8.9, 8.8 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:1000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CD44-001
 
CD44-028
 
CD44-202
 
CD44-203
 
CD44-204